RFC1 Antibody - middle region : FITC

RFC1 Antibody - middle region : FITC
SKU
AVIARP56522_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RFC1

Molecular Weight: 128kDa

Peptide Sequence: Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication factor C subunit 1

Protein Size: 1147

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP56522_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56522_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5981
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×