RGD1561459 Antibody - N-terminal region : Biotin

RGD1561459 Antibody - N-terminal region : Biotin
SKU
AVIARP55390_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1561459

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RGD1561459 Ensembl ENSRNOP00000016783

Protein Size: 124

Purification: Affinity Purified
More Information
SKU AVIARP55390_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55390_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 361606
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×