RGD1561459 Antibody - N-terminal region : HRP

RGD1561459 Antibody - N-terminal region : HRP
SKU
AVIARP55390_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1561459

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RGD1561459 Ensembl ENSRNOP00000016783

Protein Size: 124

Purification: Affinity Purified
More Information
SKU AVIARP55390_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55390_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 361606
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×