RGL3 Antibody - middle region : FITC

RGL3 Antibody - middle region : FITC
SKU
AVIARP56251_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RGL3 is a guanine nucleotide exchange factor (GEF) for Ral-A. RGL3 is a potential effector of GTPase HRas and Ras-related protein M-Ras. RGL3 negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RGL3

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ral guanine nucleotide dissociation stimulator-like 3

Protein Size: 710

Purification: Affinity Purified
More Information
SKU AVIARP56251_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56251_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57139
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×