RGS22 Antibody - N-terminal region : FITC

RGS22 Antibody - N-terminal region : FITC
SKU
AVIARP55320_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RGS22

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 147kDa

Peptide Sequence: Synthetic peptide located within the following region: QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulator of G-protein signaling 22

Protein Size: 1264

Purification: Affinity Purified
More Information
SKU AVIARP55320_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55320_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26166
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×