RHEB Antibody - middle region : HRP

RHEB Antibody - middle region : HRP
SKU
AVIARP56651_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHEB

Key Reference: Eom,M., (2008) Pathol. Int. 58 (4), 226-232

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding protein Rheb

Protein Size: 184

Purification: Affinity Purified
More Information
SKU AVIARP56651_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56651_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6009
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×