RHOF Antibody - N-terminal region : Biotin

RHOF Antibody - N-terminal region : Biotin
SKU
AVIARP57309_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state.It causes the formation of thin, actin-rich surface projections called filopodia. And it functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin- based morphology.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOF

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho-related GTP-binding protein RhoF

Protein Size: 211

Purification: Affinity Purified
More Information
SKU AVIARP57309_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57309_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54509
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×