Rimklb Antibody - N-terminal region : Biotin

Rimklb Antibody - N-terminal region : Biotin
SKU
AVIARP57439_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rimklb

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-citryl-glutamate synthase B

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP57439_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57439_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 108653
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×