RP11-269F19.9 Antibody - middle region : Biotin

RP11-269F19.9 Antibody - middle region : Biotin
SKU
AVIARP54426_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP11-269F19.9

Molecular Weight: 23

Peptide Sequence: Synthetic peptide located within the following region: VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tctex1 domain-containing protein 4

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP54426_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54426_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 343521
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×