RP11-269F19.9 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP11-269F19.9

Molecular Weight: 23

Peptide Sequence: Synthetic peptide located within the following region: VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tctex1 domain-containing protein 4

Protein Size: 221

Purification: Affinity Purified

• SKU: AVIARP54426_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54426_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 343521
• Host: Rabbit
• Conjugate: Conjugated, HRP