RP11-269F19.9 Antibody - N-terminal region : FITC

RP11-269F19.9 Antibody - N-terminal region : FITC
SKU
AVIARP54425_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RP11-269F19.9 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of RP11-269F19.9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-269F19.9

Key Reference: Meng,Q., (2006) J. Biol. Chem. 281 (48), 37069-37080

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tctex1 domain-containing protein 4

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP54425_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54425_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 343521
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×