RP11-529I10.4 Antibody - middle region : Biotin

RP11-529I10.4 Antibody - middle region : Biotin
SKU
AVIARP55257_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP11-529I10.4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein DPCD

Protein Size: 203

Purification: Affinity Purified
More Information
SKU AVIARP55257_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55257_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25911
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×