RP2 Antibody - middle region : HRP

RP2 Antibody - middle region : HRP
SKU
AVIARP56724_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP2

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein XRP2

Protein Size: 350

Purification: Affinity Purified
More Information
SKU AVIARP56724_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56724_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6102
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×