RPA1 Antibody - middle region : Biotin

RPA1 Antibody - middle region : Biotin
SKU
AVIARP56525_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. RPA1 binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA1

Key Reference: Tomida,J., (2008) J. Biol. Chem. 283 (14), 9071-9079

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Replication protein A 70 kDa DNA-binding subunit

Protein Size: 616

Purification: Affinity Purified
More Information
SKU AVIARP56525_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56525_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6117
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×