RPA1 Antibody - middle region : HRP

RPA1 Antibody - middle region : HRP
SKU
AVIARP56526_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. RPA1 binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA1

Key Reference: Tomida,J., (2008) J. Biol. Chem. 283 (14), 9071-9079

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication protein A 70 kDa DNA-binding subunit

Protein Size: 616

Purification: Affinity Purified
More Information
SKU AVIARP56526_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56526_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6117
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×