Rpl17 Antibody - C-terminal region : HRP

Rpl17 Antibody - C-terminal region : HRP
SKU
AVIARP56130_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpl17 is a component of the 60S subunit of the ribosome, the organelles that catalyze protein synthesis; member of the L22P family of ribosomal proteins; induced under amino acid deprivation of cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rpl17

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L17

Protein Size: 184

Purification: Affinity Purified
More Information
SKU AVIARP56130_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56130_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 291434
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×