Rpl5 Antibody - C-terminal region : HRP

Rpl5 Antibody - C-terminal region : HRP
SKU
AVIARP56126_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rpl5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L5

Protein Size: 297

Purification: Affinity Purified
More Information
SKU AVIARP56126_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56126_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 19983
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×