Rprd1b Antibody - C-terminal region : Biotin

Rprd1b Antibody - C-terminal region : Biotin
SKU
AVIARP57533_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rprd1b interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptional regulator which enhances expression of CCND1. It promotes binding of RNA polymerase II to the CCDN1 promoter and to the termination region before the poly-A site but decreases its binding after the poly-A site. It prevents RNA polymerase II from reading through the 3' end termination site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. It also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Rprd1b promotes cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rprd1b

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Regulation of nuclear pre-mRNA domain-containing protein 1B

Protein Size: 224

Purification: Affinity Purified
More Information
SKU AVIARP57533_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57533_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 70470
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×