RPS13 Antibody - N-terminal region : HRP

RPS13 Antibody - N-terminal region : HRP
SKU
AVIARP56179_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS13

Key Reference: Malygin,A.A., (2007) Nucleic Acids Res. 35 (19), 6414-6423

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 40S ribosomal protein S13

Protein Size: 151

Purification: Affinity Purified
More Information
SKU AVIARP56179_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56179_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6207
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×