RPS6KA2 Antibody - middle region : HRP

RPS6KA2 Antibody - middle region : HRP
SKU
AVIARP56170_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPS6KA2

Key Reference: Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribosomal protein S6 kinase alpha-2

Protein Size: 733

Purification: Affinity Purified
More Information
SKU AVIARP56170_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56170_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6196
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×