RPS6KB1 Antibody - N-terminal region : Biotin

RPS6KB1 Antibody - N-terminal region : Biotin
SKU
AVIARP56553_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1

Key Reference: Ma,X.M., (2008) Cell 133 (2), 303-313

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase beta-1

Protein Size: 525

Purification: Affinity Purified
More Information
SKU AVIARP56553_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56553_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6198
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×