RRAGC Antibody - N-terminal region : FITC

RRAGC Antibody - N-terminal region : FITC
SKU
AVIARP57618_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RRAGC

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein C

Protein Size: 399

Purification: Affinity Purified
More Information
SKU AVIARP57618_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57618_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64121
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×