RRAGD Antibody - middle region : Biotin

RRAGD Antibody - middle region : Biotin
SKU
AVIARP57542_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRAGD

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related GTP-binding protein D

Protein Size: 400

Purification: Affinity Purified
More Information
SKU AVIARP57542_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57542_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58528
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×