RSAD1 Antibody - middle region : Biotin

RSAD1 Antibody - middle region : Biotin
SKU
AVIARP57212_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RSAD1 may be involved in porphyrin cofactor biosynthesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSAD1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: NWTYWQCGQYLGVGPGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Radical S-adenosyl methionine domain-containing protein 1, mitochondrial

Protein Size: 442

Purification: Affinity Purified
More Information
SKU AVIARP57212_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57212_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55316
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×