RSPH10B Antibody - middle region : FITC

RSPH10B Antibody - middle region : FITC
SKU
AVIARP56027_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSPH10B

Key Reference: Yang,P., J. Cell. Sci. 119 (PT 6), 1165-1174 (2006)

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Radial spoke head 10 homolog B2

Protein Size: 870

Purification: Affinity Purified
More Information
SKU AVIARP56027_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56027_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222967
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×