RTKN Antibody - middle region : FITC

RTKN Antibody - middle region : FITC
SKU
AVIARP56211_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RTKN

Key Reference: Sudo,K., (2007) Hum. Mutat. 28 (10), 1005-1013

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rhotekin

Protein Size: 563

Purification: Affinity Purified
More Information
SKU AVIARP56211_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56211_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6242
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×