RWDD1 Antibody - middle region : HRP

RWDD1 Antibody - middle region : HRP
SKU
AVIARP56838_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RWDD1

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: RWD domain-containing protein 1

Protein Size: 147

Purification: Affinity Purified
More Information
SKU AVIARP56838_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56838_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51389
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×