S100A5 Antibody - N-terminal region : Biotin

S100A5 Antibody - N-terminal region : Biotin
SKU
AVIARP56529_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human S10A5

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: ETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protein S100-A5

Protein Size: 92

Purification: Affinity Purified
More Information
SKU AVIARP56529_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56529_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6276
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×