S100PBP Antibody - middle region : FITC

S100PBP Antibody - middle region : FITC
SKU
AVIARP56213_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human S100PBP

Key Reference: Deng,H., (2008) Am. J. Clin. Pathol. 129 (1), 81-88

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S100P-binding protein Ensembl ENSP00000381296

Protein Size: 341

Purification: Affinity Purified
More Information
SKU AVIARP56213_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56213_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64766
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×