SAR1B Antibody - middle region : HRP

SAR1B Antibody - middle region : HRP
SKU
AVIARP56243_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAR1B

Key Reference: Charcosset,M., (2008) Mol. Genet. Metab. 93 (1), 74-84

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding protein SAR1b

Protein Size: 198

Purification: Affinity Purified
More Information
SKU AVIARP56243_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56243_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51128
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×