SCAND2 Antibody - middle region : FITC

SCAND2 Antibody - middle region : FITC
SKU
AVIARP58173_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAND2

Key Reference: 0

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative SCAN domain-containing protein 2

Protein Size: 152

Purification: Affinity Purified
More Information
SKU AVIARP58173_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58173_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54581
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×