SCFD1 Antibody - N-terminal region : Biotin

SCFD1 Antibody - N-terminal region : Biotin
SKU
AVIARP55851_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCFD1

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: SAVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sec1 family domain containing 1, isoform CRA_b EMBL EAW65968.1

Protein Size: 575

Purification: Affinity Purified
More Information
SKU AVIARP55851_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55851_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23256
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×