SCHIP1 Antibody - C-terminal region : Biotin

SCHIP1 Antibody - C-terminal region : Biotin
SKU
AVIARP55083_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCHIP1

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: TSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTETSLDTPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Schwannomin-interacting protein 1

Protein Size: 244

Purification: Affinity Purified
More Information
SKU AVIARP55083_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55083_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29970
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×