SCO1 Antibody - middle region : Biotin

SCO1 Antibody - middle region : Biotin
SKU
AVIARP56592_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytoch

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCO1

Key Reference: Banci,L., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6803-6808

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SCO1 homolog, mitochondrial

Protein Size: 301

Purification: Affinity Purified
More Information
SKU AVIARP56592_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56592_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6341
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×