Sec14l3 Antibody - C-terminal region : Biotin

Sec14l3 Antibody - C-terminal region : Biotin
SKU
AVIARP55733_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Sec14l3 is a probable hydrophobic ligand-binding protein; It may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SEC14-like protein 3

Protein Size: 400

Purification: Affinity Purified
More Information
SKU AVIARP55733_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55733_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64543
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×