Sec14l3 Antibody - C-terminal region : HRP

Sec14l3 Antibody - C-terminal region : HRP
SKU
AVIARP55733_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sec14l3 is a probable hydrophobic ligand-binding protein; It may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SEC14-like protein 3

Protein Size: 400

Purification: Affinity Purified
More Information
SKU AVIARP55733_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55733_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64543
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×