SEC14L4 Antibody - N-terminal region : HRP

SEC14L4 Antibody - N-terminal region : HRP
SKU
AVIARP55734_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEC14L4

Key Reference: Mokashi,V., (2004) Biochem. Biophys. Res. Commun. 316 (3), 688-692

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SEC14-like protein 4

Protein Size: 406

Purification: Affinity Purified
More Information
SKU AVIARP55734_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55734_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284904
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×