Sec31a Antibody - N-terminal region : HRP

Sec31a Antibody - N-terminal region : HRP
SKU
AVIARP55111_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sec31a is a putative membrane-associated endosomal phosphoprotein.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 136kDa

Peptide Sequence: Synthetic peptide located within the following region: DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein transport protein Sec31A

Protein Size: 1249

Purification: Affinity Purified
More Information
SKU AVIARP55111_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55111_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 93646
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×