SELENOP Antibody - N-terminal region : FITC

SELENOP Antibody - N-terminal region : FITC
SKU
AVIARP56299_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a selenoprotein that is predominantly expressed in the liver and secreted into the plasma. This selenoprotein is unique in that it contains multiple selenocysteine (Sec) residues per polypeptide (10 in human), and accounts for most of the selenium in plasma. It has been implicated as an extracellular antioxidant, and in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2). Mice lacking this gene exhibit neurological dysfunction, suggesting its importance in normal brain function. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The mRNA for this selenoprotein contains two SECIS elements. Alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPP1

Key Reference: Peters,U., (2008) Cancer Epidemiol. Biomarkers Prev. 17 (5), 1144-1154

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: selenoprotein P

Protein Size: 411

Purification: Affinity Purified
More Information
SKU AVIARP56299_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56299_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6414
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×