SEPT11 Antibody - N-terminal region : FITC

SEPT11 Antibody - N-terminal region : FITC
SKU
AVIARP57173_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11)

Key Reference: Xin,X., (2007) J. Histochem. Cytochem. 55 (11), 1089-1094

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-11

Protein Size: 429

Purification: Affinity Purified
More Information
SKU AVIARP57173_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57173_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 55752
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×