SEPT2 Antibody - middle region : HRP

SEPT2 Antibody - middle region : HRP
SKU
AVIARP56661_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEPT2

Key Reference: Spiliotis,E.T., (2008) J. Cell Biol. 180 (2), 295-303

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Septin-2

Protein Size: 361

Purification: Affinity Purified
More Information
SKU AVIARP56661_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56661_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4735
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×