SEPT2 Antibody - N-terminal region : FITC

SEPT2 Antibody - N-terminal region : FITC
SKU
AVIARP56660_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2

Key Reference: Spiliotis,E.T., (2008) J. Cell Biol. 180 (2), 295-303

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Septin-2

Protein Size: 361

Purification: Affinity Purified
More Information
SKU AVIARP56660_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56660_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4735
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×