SFN Antibody - N-terminal region : Biotin

SFN Antibody - N-terminal region : Biotin
SKU
AVIARP54791_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFN

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 14-3-3 protein sigma

Protein Size: 248

Purification: Affinity Purified
More Information
SKU AVIARP54791_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54791_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2810
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×