SFRS7 Antibody - middle region : FITC

SFRS7 Antibody - middle region : FITC
SKU
AVIARP56232_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS7

Key Reference: Swartz,J.E., (2007) J. Biol. Chem. 282 (27), 19844-19853

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/arginine-rich splicing factor 7

Protein Size: 238

Purification: Affinity Purified
More Information
SKU AVIARP56232_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56232_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6432
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×