SFRS7 Antibody - N-terminal region : HRP

SFRS7 Antibody - N-terminal region : HRP
SKU
AVIARP56231_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7

Key Reference: Swartz,J.E., (2007) J. Biol. Chem. 282 (27), 19844-19853

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/arginine-rich splicing factor 7

Protein Size: 238

Purification: Affinity Purified
More Information
SKU AVIARP56231_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56231_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6432
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×