SFXN4 Antibody - C-terminal region : HRP

SFXN4 Antibody - C-terminal region : HRP
SKU
AVIARP53531_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SFXN4

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sideroflexin-4

Protein Size: 337

Purification: Affinity Purified
More Information
SKU AVIARP53531_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53531_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 119559
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×