SH3GL2 Antibody - N-terminal region : Biotin

SH3GL2 Antibody - N-terminal region : Biotin
SKU
AVIARP56549_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL2

Key Reference: Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A1

Protein Size: 352

Purification: Affinity Purified
More Information
SKU AVIARP56549_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56549_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6456
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×