SHC3 Antibody - middle region : FITC

SHC3 Antibody - middle region : FITC
SKU
AVIARP56958_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHC3

Key Reference: Villanacci,V., (2008) Neurogastroenterol. Motil. 20 (3), 206-212

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SHC-transforming protein 3

Protein Size: 594

Purification: Affinity Purified
More Information
SKU AVIARP56958_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56958_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 53358
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×