Shq1 Antibody - N-terminal region : HRP

Shq1 Antibody - N-terminal region : HRP
SKU
AVIARP57120_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Shq1 is required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Shq1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein SHQ1 homolog

Protein Size: 458

Purification: Affinity Purified
More Information
SKU AVIARP57120_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57120_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 72171
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×