SIK3 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of KIAA0999 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIK3

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: SDAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase SIK3

Protein Size: 598

Purification: Affinity Purified

• SKU: AVIARP53785_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53785_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23387
• Host: Rabbit
• Conjugate: Conjugated, Biotin